Download Latest Version v0.7.3_ Fix the bug in the code where ref_space_uid was mistakenly written as ref_mask in the cache computation. source code.tar.gz (45.5 MB)
Email in envelope

Get an email when there's a new version of Protenix

Home / v0.7.2
Name Modified Size InfoDownloads / Week
Parent folder
README.md 2025-11-20 1.3 kB
0
v0.7.2_ Allow for the absence of pairing.a3m in inference. source code.tar.gz 2025-11-20 45.5 MB
0
v0.7.2_ Allow for the absence of pairing.a3m in inference. source code.zip 2025-11-20 45.6 MB
0
Totals: 3 Items   91.0 MB 0

What's changed

  • If the directory specified by precomputed_msa_dir under the msa field in the inference file does not contain the pairing.a3m file, no error will be thrown; instead, only the non_pairing.a3m file will be used for inference. In previous versions, this would have caused an immediate error.

example.json

:::json
[{
    "sequences": [
        {
            "proteinChain": {
                "sequence": "MGSSHHHHHHSSGLVPRGSHMSGKIQHKAVVPAPSRIPLTLSEIEDLRRKGFNQTEIAELYGVTRQAVSWHKKTYGGRLTTRQIVQQNWPWDTRKPHDKSKAFQRLRDHGEYMRVGSFRTMSEDKKKRLLSWWKMLRDNDLVLEFDPSIEPYEGMAGGGFRYVPRDISDDDLLIRVNEHTQLTAEGELLWSWPDDIEELLSEP",
                "count": 1,
                "msa": {
                    "precomputed_msa_dir": "./examples/7r6r/msa/1",
                    "pairing_db": "uniref100"
                }
            }
        },
        {
            "dnaSequence": {
                "sequence": "TTTCGGTGGCTGTCAAGCGGG",
                "count": 1
            }
        },
        {
            "dnaSequence": {
                "sequence": "CCCGCTTGACAGCCACCGAAA",
                "count": 1
            }
        }
    ],
    "name": "7r6r"
}
]
Source: README.md, updated 2025-11-20