Re: [Transdecoder-users] problems of installation
Extracting likely coding regions from transcript sequences
Brought to you by:
bhaas
|
From: Zhang, N. <Zh...@si...> - 2014-01-31 15:02:07
|
Yes, the name is identical, but the sequence is different. Something like that: >Ampelocissus_ele_scaffold99_Locus_33_4_22.4 MGQKNSTHSTMEENCKWHKLLPRERERLMGTVGRRAIRSKLKNCRAMEVGIAATIRDQNG TD* >Ampelocissus_ele_scaffold99_Locus_33_4_22.4 MDRQNSFHESFPRSYRGKQFPFLQGPNPILPGTSVCQPLLDPSSASGNGSGGQKMFSDGL NRVISSDRALSLLSSPLPETQEIGLSSMVQQNPIPPAQTLIPSLHYTGLSQYASSQGMGD SVGSILVSDGSSNANLHCPAIFQLGPDGSSTNSSHQTLSFSWE* There are many cases in my .pep file. Ning On Jan 30, 2014, at 8:06 PM, <Ale...@cs...<mailto:Ale...@cs...>> <Ale...@cs...<mailto:Ale...@cs...>> wrote: Are they duplicate (two identical proteins) from one contig or two proteins (different coordinates) in a contig? A -- Alexie Papanicolaou CSIRO Ecosystem Sciences ________________________________ From: Zhang, Ning Sent: Thursday, 30 January 2014 9:56:19 PM To: Papanicolaou, Alexie (CES, Black Mountain) Cc: <tra...@li...<mailto:tra...@li...>> Subject: Re: [Transdecoder-users] problems of installation Hi, all: I found that there are some duplicate peptides in *.transdecoder.pep. What happened? How can I get only one peptide for each contig, maybe the longest one. Thanks Ning On Jan 25, 2014, at 7:55 AM, Zhang, Ning wrote: yes, I made it. After installing this module, it works. If you use Transdecoder on cluster, you had better install the module at your own path. A module named local::lib which enables you install perl modules at your own path, so you needn't ask admin for help. Ning On Jan 25, 2014, at 1:33 AM, <Ale...@cs...<mailto:Ale...@cs...>> <Ale...@cs...<mailto:Ale...@cs...>> wrote: It seems that you or your sysadmin will have to install the perl module: $ cpan URI::Escape If you are familiar with cpan, I'd recommend you do it yourself, otherwise pls ask your sysadmin Brian: we may have to make a list of all the different module dependencies at some point and just create a CPAN bundle... a -- Dr. Alexie Papanicolaou Phone: +61(0) 2 6246 4511| Mobile: +61 (0) 46 85 81 247 CSIRO Ecosystem Sciences, GPO Box 1700, Canberra 2601, ACT, Australia -- CSIRO profile<https://urldefense.proofpoint.com/v1/url?u=http://www.csiro.au/Organisation-Structure/Divisions/Ecosystem-Sciences/AlexiePapanicolaou.aspx&k=diZKtJPqj4jWksRIF4bjkw%3D%3D%0A&r=pLScI1VMNxHqdwIgs2R8Mg%3D%3D%0A&m=hN8coJf7sbIVLVZD%2FAqPfuOKF2zi7gdTl9WMkrF0MPw%3D%0A&s=48cc7bddc3e9fff5c131a2f4ca76b66cad324a17ff02929558bc2191336f1744> -- ResearcherID<https://urldefense.proofpoint.com/v1/url?u=http://www.researcherid.com/rid/A-1618-2011&k=diZKtJPqj4jWksRIF4bjkw%3D%3D%0A&r=pLScI1VMNxHqdwIgs2R8Mg%3D%3D%0A&m=hN8coJf7sbIVLVZD%2FAqPfuOKF2zi7gdTl9WMkrF0MPw%3D%0A&s=5b2d419ad1f31ad2bbaadeb5d7c6b74bd08888dd929ae8933194347cc2dd0d3e> -- Bioinformatics is also an experimental science ________________________________ From: Zhang, Ning [Zh...@si...<mailto:Zh...@si...>] Sent: Saturday, 25 January 2014 6:06 AM To: tra...@li...<mailto:tra...@li...> Subject: [Transdecoder-users] problems of installation Hi, all: I installed the latest Transdecoder with the command "make", however, when I run it, I got error message. Can't locate URI/Escape.pm in @INC (@INC contains: /home/zhangn/software/transdecoder_rel16JAN2014/PerlLib /home/zhangn/localperl/lib/site_perl/5.16.3/x86_64-linux /home/zhangn/localperl/lib/site_perl/5.16.3 /home/zhangn/localperl/lib/5.16.3/x86_64-linux /home/zhangn/localperl/lib/5.16.3 .) at /home/zhangn/software/transdecoder_rel16JAN2014/PerlLib/Gene_obj.pm line 15. BEGIN failed--compilation aborted at /home/zhangn/software/transdecoder_rel16JAN2014/PerlLib/Gene_obj.pm line 15. Compilation failed in require at ./TransDecoder line 102. BEGIN failed--compilation aborted at ./TransDecoder line 102. what is wrong with my installation. Thanks. Ning Zhang ------------------------------------------------------------------------------ CenturyLink Cloud: The Leader in Enterprise Cloud Services. Learn Why More Businesses Are Choosing CenturyLink Cloud For Critical Workloads, Development Environments & Everything In Between. Get a Quote or Start a Free Trial Today. https://urldefense.proofpoint.com/v1/url?u=http://pubads.g.doubleclick.net/gampad/clk?id%3D119420431%26iu%3D/4140/ostg.clktrk&k=diZKtJPqj4jWksRIF4bjkw%3D%3D%0A&r=pLScI1VMNxHqdwIgs2R8Mg%3D%3D%0A&m=Y7O%2FsAwF6WOeHlIyNChT%2BwaySpIVL8mcPQA5zguHj4s%3D%0A&s=d5aa942dbe90f9c4cee4ace02d5ae1325472ee07cfbb022ee55849276e387cdb_______________________________________________ Transdecoder-users mailing list Tra...@li...<mailto:Tra...@li...> https://urldefense.proofpoint.com/v1/url?u=https://lists.sourceforge.net/lists/listinfo/transdecoder-users&k=diZKtJPqj4jWksRIF4bjkw%3D%3D%0A&r=pLScI1VMNxHqdwIgs2R8Mg%3D%3D%0A&m=Y7O%2FsAwF6WOeHlIyNChT%2BwaySpIVL8mcPQA5zguHj4s%3D%0A&s=8c9eb782b20a3b7360b0edc5a5b5bc9fec97c9de3a1f28a000673bb1f01d8bae |