From: Sucheta T. <su...@vb...> - 2004-07-01 19:31:26
|
Steve, Following is the data snippet. ******************* /translation="MEAADAADSVLHGDLLECVLLRVPHGELTASPALVSREWRRAAR EAHQRHRRRRRHLPCLVAHVHGAAAGVGRSTHVYDPRAGAWASDGWRVAGALPVRRCA CAGGDRVYALSLASMAVSEDAVGAAWRELPPPRVWRVDPVVAAVGPHVVVLGGGCGAT AAAGVVEVLDEGAGWATCPPMPAPLASRWVSSAASERRVYVVERRTGWASWFDPAARQ WGPARQLQLPEGNNTASVESWAACGVTTSGGGGASERLLVLAGGGGGKVSLWGVDGDT LLLDAEANNTSMPPEMSERLGGAGSIAAAAAGAASGYVYNASEPSKGAVRYELVDAEV GGGHGSYSDSDSKNGRHEKTWGKRSSGGSRWEWEWLPCPPAAAAAMSTSSSAVVVFAC CGSSSAPNK" gene join(22480..22704,23721..23786) /gene="OJ1342_D02.4" misc_feature join(22480..22704,23721..23786) /gene="OJ1342_D02.4" /note="gag-pol polyprotein-like" gene complement(25925..26257) /gene="OJ1342_D02.5" mRNA complement(<25925..>26257) /gene="OJ1342_D02.5" /note="start and end point are not identified" CDS complement(25925..26257) /gene="OJ1342_D02.5" /note="predicted by FGENESH etc." /codon_start=1 /product="hypothetical protein" /protein_id="BAD19559.1" /db_xref="GI:47497506" ************************************* In this case the prediction was by FGENESH. Sucheta At 02:43 PM 7/1/2004 -0400, you wrote: >sucheta- > >can you clarify where the prediction_program_algorithm is used in your >data. Is it in a genbank file? can you provide a snippet of that data? > >thanks, >steve > >Sucheta Tripathy wrote: > >>Hi, >> >>My most immediate concern is about locating where the >>prediction_program_algorithm is stored in GUS. Here I mean the gene >>prediction programs like genscan, glimmer etc. >> >>In some of the views which gets data from NAFeatureIMP though I see >>prediction_algorithm_id but that refers to core.algorithm, and which just >>stores the plugin information, that are used in the current project. >>For example in our core.algorithm table the following is the data: >>id Name >>=== ===== >>1 SQL*PLUS >>2 GA-Plugin >>3 GUS::Common::Plugin::SubmitRow >>4 GUS::Common::Plugin::LoadTaxon >>5 GUS::GOPredict::Plugin::LoadGoOntology >>.... >>So the prediction_algorithm_id is wrongly pointing to core.algorithm?? >> >> >>thanks >>Sucheta >> >> >> >>------------------------------------------------------- >>This SF.Net email sponsored by Black Hat Briefings & Training. >>Attend Black Hat Briefings & Training, Las Vegas July 24-29 - digital >>self defense, top technical experts, no vendor pitches, unmatched >>networking opportunities. Visit www.blackhat.com >>_______________________________________________ >>Gusdev-gusdev mailing list >>Gus...@li... >>https://lists.sourceforge.net/lists/listinfo/gusdev-gusdev > |