From: Fidel S. <fi...@vb...> - 2004-05-11 18:39:39
|
Angel, Thanks. A day or two works for me. Fidel Angel Pizarro <an...@pc...> writes: > Fidel, > I'll look into this problem. It may take me a bit of time to do so > (like a day or two) and get back to you with a full answer. > Angel > > Fidel Salas wrote: > >>I used the GBParser plugin to upload some GenBank entry which contains >>thousands of features. However, only 33 features are found in the >>database. >> >>The features found in the database are exemplified by the following >>two features from the GenBank file: >> gene complement(142270..143373) >> /gene="lys9" >> /locus_tag="APE0193m" >> /db_xref="GeneID:1445541" >> CDS complement(142270..143373) >> /gene="lys9" >> /locus_tag="APE0193m" >> /codon_start=1 >> /transl_table=11 >> /product="saccharopine dehydrogenase" >> /protein_id="NP_147035.1" >> /db_xref="GI:14602185" >> /db_xref="GeneID:1445541" >> /translation="MVKIAVLGLGRVGLRAAYNLASRGFDVLGLDASNDAVSRARSLG >> LEARLYDVEGRKAGEYLRGQRVVAAFIALPYPVASRAVAHLSSAGIPVVVASIKPLRI >> DPGVVRAPILTEVGVSPGLSNVILYSMAAETGGGVSARVYVGSFGAREDGLLSHASTW >> RVEEMLEQYVTPAKLIQDGSEAVADPLDPSLWMEYSDPEHGVLECFPSQGLAGFISRR >> GSLFKELMECSLRRRGHLKVVLTMRGLGLLDSTPLKVSGCIVRPFDMAVKLVETRYPP >> DVGDVAVFTVEARRGGRWETLARASLRHGGGWSASSKMVGGASSAFAEVFAAEGLSEE >> EPGIIYPEDLYELGLAEKLLSLLPSHGVSLEVG" >> >> >>The ones that did not make it in look like this: >> gene complement(213..938) >> /locus_tag="APE0001" >> /db_xref="GeneID:1445602" >> CDS complement(213..938) >> /locus_tag="APE0001" >> /codon_start=1 >> /transl_table=11 >> /product="hypothetical protein" >> /protein_id="NP_146894.1" >> /db_xref="GI:14600380" >> /db_xref="GeneID:1445602" >> /translation="MVDILSSLLLSLPFGVIGFLLVLSPGSIWTPVKESIGYVYVSRR >> VTVKASKLLGSLTLLASLISFVVGAAYGITIQASTLALLLALITVVTVEYSMRLAEIE >> SLNQPVLEGFEPVGSIKLKYLTIILLVYLISIVFSIEGSLKLYSIGAYGTLASHLSIE >> ILAGYTVFLSVKRPEAYVIPGLSRETIELLQFFMPTSLSLIAIGVYMILAGFHMWWII >> LLAGVTTLFVVTMLIMINKEGKY" >> gene complement(938..1276) >> /locus_tag="APE0002" >> /db_xref="GeneID:1445577" >> >>The one element that is present in the features that are uploaded but >>absent in those that do not is the gene qualifier. >> >>Looking at the schema it is not obvious to me why the gene qualifier >>needs to be present in a feature in order to be uploaded. Am I >>missing something more obvious? >> >>Thanks >> >>Fidel >> >> >> |