From: Angel P. <an...@pc...> - 2004-05-11 15:37:43
|
Fidel, I'll look into this problem. It may take me a bit of time to do so (like a day or two) and get back to you with a full answer. Angel Fidel Salas wrote: >I used the GBParser plugin to upload some GenBank entry which contains >thousands of features. However, only 33 features are found in the >database. > >The features found in the database are exemplified by the following >two features from the GenBank file: > gene complement(142270..143373) > /gene="lys9" > /locus_tag="APE0193m" > /db_xref="GeneID:1445541" > CDS complement(142270..143373) > /gene="lys9" > /locus_tag="APE0193m" > /codon_start=1 > /transl_table=11 > /product="saccharopine dehydrogenase" > /protein_id="NP_147035.1" > /db_xref="GI:14602185" > /db_xref="GeneID:1445541" > /translation="MVKIAVLGLGRVGLRAAYNLASRGFDVLGLDASNDAVSRARSLG > LEARLYDVEGRKAGEYLRGQRVVAAFIALPYPVASRAVAHLSSAGIPVVVASIKPLRI > DPGVVRAPILTEVGVSPGLSNVILYSMAAETGGGVSARVYVGSFGAREDGLLSHASTW > RVEEMLEQYVTPAKLIQDGSEAVADPLDPSLWMEYSDPEHGVLECFPSQGLAGFISRR > GSLFKELMECSLRRRGHLKVVLTMRGLGLLDSTPLKVSGCIVRPFDMAVKLVETRYPP > DVGDVAVFTVEARRGGRWETLARASLRHGGGWSASSKMVGGASSAFAEVFAAEGLSEE > EPGIIYPEDLYELGLAEKLLSLLPSHGVSLEVG" > > >The ones that did not make it in look like this: > gene complement(213..938) > /locus_tag="APE0001" > /db_xref="GeneID:1445602" > CDS complement(213..938) > /locus_tag="APE0001" > /codon_start=1 > /transl_table=11 > /product="hypothetical protein" > /protein_id="NP_146894.1" > /db_xref="GI:14600380" > /db_xref="GeneID:1445602" > /translation="MVDILSSLLLSLPFGVIGFLLVLSPGSIWTPVKESIGYVYVSRR > VTVKASKLLGSLTLLASLISFVVGAAYGITIQASTLALLLALITVVTVEYSMRLAEIE > SLNQPVLEGFEPVGSIKLKYLTIILLVYLISIVFSIEGSLKLYSIGAYGTLASHLSIE > ILAGYTVFLSVKRPEAYVIPGLSRETIELLQFFMPTSLSLIAIGVYMILAGFHMWWII > LLAGVTTLFVVTMLIMINKEGKY" > gene complement(938..1276) > /locus_tag="APE0002" > /db_xref="GeneID:1445577" > >The one element that is present in the features that are uploaded but >absent in those that do not is the gene qualifier. > >Looking at the schema it is not obvious to me why the gene qualifier >needs to be present in a feature in order to be uploaded. Am I >missing something more obvious? > >Thanks > >Fidel > > > > |