[Gmod-schema] Chado assistance

[Inderski, B. - A. <Blake.Inderski@ARS.USDA.GOV>]

Greetings!

I’m new to Chado and uncertain on how to properly integrate data into the existing Chado schema. My target organism is Porcine Reproductive and Respiratory Syndrome Virus (PRRSV), a single stranded, positive sense RNA virus with a genome approximately 15kb in length. Below are the data fields I’m planning to include, as well as related examples:

Metadata
Unique ID (automatically generated, sequential identifier) – GB:0000000001
GenBank accession - U40784
Strain/isolate – PRRSv 92V058
Sample isolate source – serum, lymph node, etc.
Genotype – Type 1 or Type 2
Author – Doe, J.
Sample collection location (state/country) - North Carolina, USA
Sample collection date – 30-Dec-2015

Sequencing data
Raw DNA sequence – tttggtaatgtgtcaggcattgtggctgtgtgtgtta…
Open reading frame (ORF) and non-structural protein (nsp) type – ORF1ab, ORF2, nsp1, nsp12
ORF/nsp location (relative to raw DNA sequence) – 3-501
ORF/nsp translation – MAAATLFLLAGAQHIMVSEAFACKPCFSTHLSD…

Any help is much appreciated!

Thanks,
Blake







This electronic message contains information generated by the USDA solely for the intended recipients. Any unauthorized interception of this message or the use or disclosure of the information it contains may violate the law and subject the violator to civil or criminal penalties. If you believe you have received this message in error, please notify the sender and delete the email immediately.